PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02103.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 652aa    MW: 72420.4 Da    PI: 11.5995
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02103.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.32.3e-15415462148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT+eEd+ lv  ++++G  +W++ ++  g+ R++k+c++rw +yl
  Zmw_sc02103.1.g00030.1.am.mk 415 KGPWTPEEDKVLVAHIQRFGHSNWRALPKQAGLLRCGKSCRLRWINYL 462
                                   79******************************99************97 PP

2Myb_DNA-binding538.1e-17468513148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   rg++T+eE++++++++++lG++ W++Ia++++ gRt++++k+ w+++l
  Zmw_sc02103.1.g00030.1.am.mk 468 RGNFTKEEEDIIIQLHELLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 513
                                   89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-24406465IPR009057Homeodomain-like
PROSITE profilePS5129414.667410462IPR017930Myb domain
SuperFamilySSF466892.38E-30411509IPR009057Homeodomain-like
SMARTSM007173.2E-12414464IPR001005SANT/Myb domain
PfamPF002491.5E-13415462IPR001005SANT/Myb domain
CDDcd001671.74E-9417462No hitNo description
PROSITE profilePS5129426.557463517IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-26466517IPR009057Homeodomain-like
SMARTSM007176.7E-16467515IPR001005SANT/Myb domain
PfamPF002491.2E-15468513IPR001005SANT/Myb domain
CDDcd001671.35E-11470513No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 652 aa     Download sequence    Send to blast
MGKYITPVAL ARVRPSELAD RDTPAAAVVV PVKATATRGR GGGFSRALAR DLFVVVLARR  60
CPIRAWSLTI RRNPAGRTCS ANGDGRRRRA KRVHGLLEQF VTVTKRTGAS LNTSSFEKSF  120
RPDSFRATVD GPARVVWTGV RSRAPRAYAR RRSSYQLKRV ASAAEKKGDG RPSGLIAAKT  180
FAPGRRAGAR ETRRGHTCTG AVETTDRCRA GRGGVQVQRR ASERSERGWR SPDSTRLRRA  240
PRLGTTRSVL LARVKTLRVF ASSRSRGCGM DASVNFYELA VSAAAAGVFP RCSFVLQLSF  300
RSPLIFRNER WDHGVSSPPL NCRVTPLCAG QRWKLPGTAQ HISARFLQAH SAPRINTRTR  360
RTQASAPFFP QRQRERRAYL STRSSPQLDR PGQEDLQRRR AMGRAPCCEK MGLKKGPWTP  420
EEDKVLVAHI QRFGHSNWRA LPKQAGLLRC GKSCRLRWIN YLRPDIKRGN FTKEEEDIII  480
QLHELLGNRW SAIAARLPGR TDNEIKNVWH THLKKRLEPT KQDHAPAAGA SKKKQKRAGA  540
KKTPEEVTAA ATPVSPERSF SSSVTESSMT EQGKTGSSGF SKDESFTSSE EFQIDDSFWS  600
EALSMPLESF DVPMDESFGV PVGTSSAGGA EDMDYWVKLF METDGVQELP QI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-274135185109B-MYB
1h8a_C8e-2741351725128MYB TRANSFORMING PROTEIN
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563